PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna32268.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 280aa    MW: 31254 Da    PI: 4.7664
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna32268.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
  mrna32268.1-v1.0-hybrid 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding53.74.6e-1770111447
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  mrna32268.1-v1.0-hybrid  70 LTESEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                              69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.027961IPR017930Myb domain
SuperFamilySSF466894.39E-2711108IPR009057Homeodomain-like
SMARTSM007178.5E-131363IPR001005SANT/Myb domain
PfamPF002498.8E-151461IPR001005SANT/Myb domain
CDDcd001673.27E-91661No hitNo description
PROSITE profilePS5129427.48462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2564116IPR009057Homeodomain-like
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002492.2E-1569111IPR001005SANT/Myb domain
CDDcd001673.74E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL TESEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLRMG  120
IDPVTHELLH KDQDDLANKE TTISSHTDPA NSNLPQSTAE NSSSNSSPAE NSSSISSPNE  180
NPSTGDDQST LIDSICNIDE SLMNSLWVDE TPLIDALWNN DQVADGGNYI ENGMGMVSNW  240
EENCSWLLDC QDFGVHDFGM DCFIDTELNA LDTLGIEKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004298679.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX61e-102ODO1_PETHY; Protein ODORANT1
TrEMBLM5WYP61e-138M5WYP6_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s07830.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.12e-97myb domain protein 85